PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BS_EF67E5A24.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 458aa    MW: 49300.5 Da    PI: 7.99
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BS_EF67E5A24.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.51.2e-32185244160
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                            ++DgynWrKYGqK+vkgse+prsYY+Ct+++C++kkkvers  d+++++i+Y+g H+h+k
  Traes_1BS_EF67E5A24.1 185 VEDGYNWRKYGQKQVKGSENPRSYYKCTYNNCSMKKKVERSLADGRITQIVYKGAHDHPK 244
                            58********************************************************85 PP

2WRKY103.41.3e-32333391159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDg++WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d+++v++tYeg+H h+
  Traes_1BS_EF67E5A24.1 333 LDDGFRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERASHDNRAVITTYEGRHSHD 391
                            59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.9E-28179245IPR003657WRKY domain
PROSITE profilePS5081125.924180245IPR003657WRKY domain
SuperFamilySSF1182901.01E-25183245IPR003657WRKY domain
SMARTSM007741.4E-34185244IPR003657WRKY domain
PfamPF031061.4E-24186243IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-35318393IPR003657WRKY domain
SuperFamilySSF1182908.24E-29325393IPR003657WRKY domain
PROSITE profilePS5081137.252328393IPR003657WRKY domain
SMARTSM007748.7E-38333392IPR003657WRKY domain
PfamPF031063.3E-25334391IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MSSPTGSLDH AGFTFTPPPF ITSFTELLSG SGAGDVEGSP RGFNRGGRAG VPKFKSAQPP  60
SLPISSPASP FSCFSIPAGL SPAELLHSPV LLNYSHILAS PTTGAIPARR YDWQASADLN  120
TFQQDEVGRG DSGLFGFSFH AVKPNATVNA QTNYLPLFKE HQQQQQQQVV EVSNKSSSGD  180
NNKQVEDGYN WRKYGQKQVK GSENPRSYYK CTYNNCSMKK KVERSLADGR ITQIVYKGAH  240
DHPKPPSTRR NSSGCAAVIA EDHTNGSEHS GPTPENSSVT FGDDEADNGA EPETKRRKEH  300
GDNEGSSGGT GACVKPVREP TLVVQTLSDI DILDDGFRWR KYGQKVVKGN PNPRSYYKCT  360
TVGCPVRKHV ERASHDNRAV ITTYEGRHSH DVPVGRGAGA SRALPTSSSS DSSVVVCPAA  420
AGQAPYTLEM LANPAAGHRG YAAKDEPRDD MFVESLLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-34185393877Probable WRKY transcription factor 4
2lex_A6e-34185393877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6654270.0EU665427.1 Triticum aestivum WRKY14 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962416.10.0PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P54e-98WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLW5AC020.0W5AC02_WHEAT; Uncharacterized protein
STRINGSi021956m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85333448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.16e-92WRKY DNA-binding protein 26
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]